Lineage for d1jqma_ (1jqm A:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069991Domain d1jqma_: 1jqm A: [63235]
    Fitting of L11 protein and elongation factor G (EF-G) in the cryo-EM map

Details for d1jqma_

PDB Entry: 1jqm (more details)

PDB Description: Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S ribosome bound with EF-G, GDP and fusidic acid
PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1jqma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqma_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d1jqma_:

Click to download the PDB-style file with coordinates for d1jqma_.
(The format of our PDB-style files is described here.)

Timeline for d1jqma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jqmb_