SCOP 1.71: Domain d1jqlb_: 1jql B:

Lineage for d1jqlb_ (1jql B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)

7. Species Escherichia coli [TaxId:562] [64034] (5 PDB entries)

8. Domain d1jqlb_: 1jql B: [63234]
   Other proteins in same PDB: d1jqla1, d1jqla2, d1jqla3
   N-terminal subdomain only
   mutant

Details for d1jqlb_

PDB Entry: 1jql, 2.5 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)

SCOP Domain Sequences for d1jqlb_:

Sequence; same for both SEQRES and ATOM records:

>d1jqlb_ c.37.1.20 (B:) delta subunit of DNA polymerase III, N-domain {Escherichia coli}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcq

Timeline for d1jqlb_:

• d1jqlb_ first appeared in SCOP 1.57
  
• d1jqlb_ appears in SCOP 1.69
  
• d1jqlb_ appears in SCOP 1.73
  
• d1jqlb_ appears in the current release, SCOPe 2.08