![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64034] (3 PDB entries) |
![]() | Domain d1jqlb_: 1jql B: [63234] Other proteins in same PDB: d1jqla1, d1jqla2, d1jqla3 N-terminal subdomain only |
PDB Entry: 1jql (more details), 2.5 Å
SCOP Domain Sequences for d1jqlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqlb_ c.37.1.20 (B:) delta subunit of DNA polymerase III, N-domain {Escherichia coli} mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska qenaawftalanrsvqvtcq
Timeline for d1jqlb_: