Lineage for d1jqlb_ (1jql B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122588Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)
  7. 122589Species Escherichia coli [TaxId:562] [64034] (3 PDB entries)
  8. 122590Domain d1jqlb_: 1jql B: [63234]
    Other proteins in same PDB: d1jqla1, d1jqla2, d1jqla3

Details for d1jqlb_

PDB Entry: 1jql (more details), 2.5 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)

SCOP Domain Sequences for d1jqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqlb_ c.37.1.13 (B:) delta subunit of DNA polymerase III, N-domain {Escherichia coli}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcq

SCOP Domain Coordinates for d1jqlb_:

Click to download the PDB-style file with coordinates for d1jqlb_.
(The format of our PDB-style files is described here.)

Timeline for d1jqlb_: