Lineage for d1jqla3 (1jql A:245-366)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1040998Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 1040999Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 1041000Species Escherichia coli [TaxId:562] [55982] (10 PDB entries)
    Uniprot P00583
  8. 1041051Domain d1jqla3: 1jql A:245-366 [63233]
    Other proteins in same PDB: d1jqlb_
    protein/DNA complex

Details for d1jqla3

PDB Entry: 1jql (more details), 2.5 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)
PDB Compounds: (A:) DNA Polymerase III, BETA CHAIN

SCOPe Domain Sequences for d1jqla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqla3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOPe Domain Coordinates for d1jqla3:

Click to download the PDB-style file with coordinates for d1jqla3.
(The format of our PDB-style files is described here.)

Timeline for d1jqla3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jqlb_