Lineage for d1jqca_ (1jqc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703497Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2703500Domain d1jqca_: 1jqc A: [63229]
    complexed with hg, mn

Details for d1jqca_

PDB Entry: 1jqc (more details), 1.61 Å

PDB Description: Mn substituted Ribonucleotide reductase R2 from E. Coli oxidized by hydrogen peroxide and hydroxylamine
PDB Compounds: (A:) protein r2 of ribonucleotide reductase

SCOPe Domain Sequences for d1jqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqca_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

SCOPe Domain Coordinates for d1jqca_:

Click to download the PDB-style file with coordinates for d1jqca_.
(The format of our PDB-style files is described here.)

Timeline for d1jqca_: