Class b: All beta proteins [48724] (180 folds) |
Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily) core: barrel, closed; n=7, S=8; complex topology |
Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) automatically mapped to Pfam PF00716 |
Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 proteins) |
Protein Human cytomegalovirus protease [50791] (1 species) |
Species Human cytomegalovirus [TaxId:10359] [50792] (15 PDB entries) |
Domain d1jq7a_: 1jq7 A: [63227] complexed with 0fp; mutant |
PDB Entry: 1jq7 (more details), 3 Å
SCOPe Domain Sequences for d1jq7a_:
Sequence, based on SEQRES records: (download)
>d1jq7a_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]} qsqavapvyvggflarydqspdeaelllprdvvehwlhaqgqgqpslsvalplninhddt avvghvaamqsvrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsg syaglslssrrcddveqatslsgsettpfkhvalcsvgrrrgtlavygrdpewvtqrfpd ltaadrdglraqwqrcgstavdasgdpfrsdsygllgnyvdalyirerlpklrydkqlvg vteresyvka
>d1jq7a_ b.57.1.1 (A:) Human cytomegalovirus protease {Human cytomegalovirus [TaxId: 10359]} qsqavapvyvggflarydqspdeaelllprdvvehwlsvalplninhddtavvghvaamq svrdglfclgcvtsprfleivrrasekselvsrgpvsplqpdkvveflsgsyaglslssp fkhvalcsvgrrrgtlavygrdpewvtqrfpdltaadrdglraqwdpfrsdsygllgnyv dalyirerlpklrydkqlvgvteresyvka
Timeline for d1jq7a_: