Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein) |
Protein Undecaprenyl diphosphate synthase [64007] (2 species) |
Species Escherichia coli [TaxId:562] [64009] (1 PDB entry) |
Domain d1jp3b_: 1jp3 B: [63222] complexed with egc; mutant |
PDB Entry: 1jp3 (more details), 1.8 Å
SCOP Domain Sequences for d1jp3b_:
Sequence, based on SEQRES records: (download)
>d1jp3b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli} gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan
>d1jp3b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli} gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssalme lfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanygg rwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllw qiayaelyftdvlwpdfdeqdfegalnafan
Timeline for d1jp3b_: