Lineage for d1jp3a_ (1jp3 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322597Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 322598Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 322599Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)
  6. 322600Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 322601Species Escherichia coli [TaxId:562] [64009] (1 PDB entry)
  8. 322602Domain d1jp3a_: 1jp3 A: [63221]

Details for d1jp3a_

PDB Entry: 1jp3 (more details), 1.8 Å

PDB Description: Structure of E.coli undecaprenyl pyrophosphate synthase

SCOP Domain Sequences for d1jp3a_:

Sequence, based on SEQRES records: (download)

>d1jp3a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records): (download)

>d1jp3a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
wqiayaelyftdvlwpdfdeqdfegalnafanre

SCOP Domain Coordinates for d1jp3a_:

Click to download the PDB-style file with coordinates for d1jp3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jp3a_: