SCOP 1.57: Domain d1jou.2: 1jou C:,D:

Lineage for d1jou.2 (1jou C:,D:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (116 PDB entries)

8. Domain d1jou.2: 1jou C:,D: [63219]

Details for d1jou.2

PDB Entry: 1jou, 1.8 Å

PDB Description: crystal structure of native s195a thrombin with an unoccupied active site

SCOP Domain Sequences for d1jou.2:

Sequence; same for both SEQRES and ATOM records:

>g1jou.2 b.47.1.2 (C:,D:) Thrombin {Human (Homo sapiens)}
tseyqtffnprtfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigms
pwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtrye
rniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqa
gykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykp
degkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqk
vidqf

Timeline for d1jou.2:

• d1jou.2 is new in SCOP 1.57
  
• d1jou.2 appears in SCOP 1.59
  
• d1jou.2 appears in the current release, SCOPe 2.08