SCOP 1.75: Domain d1jou.1: 1jou A:,B:

Lineage for d1jou.1 (1jou A:,B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (164 PDB entries)
   Uniprot P00734 331-361,364-421
   Uniprot P00734 334-360 364-510 518-619
   Uniprot P00734 328-620
   Uniprot P00734 355-621
   Uniprot P00734 328-620
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1jou.1: 1jou A:,B: [63218]

Details for d1jou.1

PDB Entry: 1jou, 1.8 Å

PDB Description: crystal structure of native s195a thrombin with an unoccupied active site

PDB Compounds: (A:) Thrombin, light chain, (B:) Thrombin, heavy chain

SCOP Domain Sequences for d1jou.1:

Sequence; same for both SEQRES and ATOM records:

>g1jou.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
seyqtffnprtfgsgeadcglrplfekksledkterellesyidgXivegsdaeigmspw
qvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryern
iekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagy
kgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpde
gkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi
dqfge

Timeline for d1jou.1:

• d1jou.1 first appeared in SCOP 1.57
  
• d1jou.1 appears in SCOP 1.73
  
• d1jou.1 appears in SCOPe 2.01
  
• d1jou.1 appears in the current release, SCOPe 2.08