Lineage for d1joka_ (1jok A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058099Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2058100Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2058101Protein Staphylococcal nuclease [50201] (1 species)
  7. 2058102Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 2058362Domain d1joka_: 1jok A: [63214]
    complexed with thp

Details for d1joka_

PDB Entry: 1jok (more details)

PDB Description: averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1joka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joka_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqllrkseaqakkeklniwsednadsgq

SCOPe Domain Coordinates for d1joka_:

Click to download the PDB-style file with coordinates for d1joka_.
(The format of our PDB-style files is described here.)

Timeline for d1joka_: