SCOPe 2.02: Domain d1joeb_: 1joe B:

Lineage for d1joeb_ (1joe B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)
   S-ribosylhomocysteinase

7. Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries)

8. Domain d1joeb_: 1joe B: [63211]
   complexed with hg, zn

Details for d1joeb_

PDB Entry: 1joe, 2.4 Å

PDB Description: crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae

PDB Compounds: (B:) autoinducer-2 production protein

SCOPe Domain Sequences for d1joeb_:

Sequence; same for both SEQRES and ATOM records:

>d1joeb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Haemophilus influenzae [TaxId: 727]}
vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
gsytehsledaheiaknviargigvnkn

Timeline for d1joeb_:

• d1joeb_ first appeared in SCOP 1.57
  
• d1joeb_ appears in SCOPe 2.01
  
• d1joeb_ appears in SCOPe 2.03
  
• d1joeb_ appears in the current release, SCOPe 2.08