Lineage for d1joeb_ (1joe B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005425Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 3005426Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 3005444Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries)
  8. 3005448Domain d1joeb_: 1joe B: [63211]
    complexed with hg, zn

Details for d1joeb_

PDB Entry: 1joe (more details), 2.4 Å

PDB Description: crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
PDB Compounds: (B:) autoinducer-2 production protein

SCOPe Domain Sequences for d1joeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joeb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Haemophilus influenzae [TaxId: 727]}
vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
gsytehsledaheiaknviargigvnkn

SCOPe Domain Coordinates for d1joeb_:

Click to download the PDB-style file with coordinates for d1joeb_.
(The format of our PDB-style files is described here.)

Timeline for d1joeb_: