Lineage for d1jodb_ (1jod B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073753Fold b.94: Olfactory marker protein [63696] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2073754Superfamily b.94.1: Olfactory marker protein [63697] (1 family) (S)
    automatically mapped to Pfam PF06554
  5. 2073755Family b.94.1.1: Olfactory marker protein [63698] (1 protein)
  6. 2073756Protein Olfactory marker protein [63699] (2 species)
  7. 2073757Species Mouse (Mus musculus) [TaxId:10090] [63700] (3 PDB entries)
  8. 2073762Domain d1jodb_: 1jod B: [63209]
    complexed with cac, zn

Details for d1jodb_

PDB Entry: 1jod (more details), 3.2 Å

PDB Description: Crystal Structure of Murine Olfactory Marker Protein in Spacegroup P43212
PDB Compounds: (B:) Olfactory Marker Protein

SCOPe Domain Sequences for d1jodb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jodb_ b.94.1.1 (B:) Olfactory marker protein {Mouse (Mus musculus) [TaxId: 10090]}
dgpqkqqlemplvldqdltqqmrlrveslkqrgekkqdgeklirpaesvyrldfiqqqkl
qfdhwnvvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwneadal
efgerlsdlakirkvmyflitfgegvepanlkasvvfnql

SCOPe Domain Coordinates for d1jodb_:

Click to download the PDB-style file with coordinates for d1jodb_.
(The format of our PDB-style files is described here.)

Timeline for d1jodb_: