Lineage for d1jnfa2 (1jnf A:335-676)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522358Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2522470Protein Transferrin [53897] (3 species)
  7. 2522501Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries)
  8. 2522504Domain d1jnfa2: 1jnf A:335-676 [63197]
    complexed with cl, co3, fe

Details for d1jnfa2

PDB Entry: 1jnf (more details), 2.6 Å

PDB Description: rabbit serum transferrin at 2.6 a resolution.
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d1jnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnfa2 c.94.1.2 (A:335-676) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lqdeckavkwcalghherlkcdewsvtsggliecesaetpedciakimngeadamsldgg
yvyiagqcglvpvlaenyestdckkapeegylsvavvkksnpdinwnnlegkkschtavd
rtagwnipmgllynrinhcrfdeffrqgcapgsqknsslcelcvgpsvcapnnregyygy
tgafrclvekgdvafvksqtvlqntggrnsepwakdlkeedfellcldgtrkpvseahnc
hlakapnhavvsrkdkaacvkqklldlqvefgntvadcsskfcmfhsktkdllfrddtkc
lvdlrgkntyekylgadyikavsnlrkcstsrlleactfhkh

SCOPe Domain Coordinates for d1jnfa2:

Click to download the PDB-style file with coordinates for d1jnfa2.
(The format of our PDB-style files is described here.)

Timeline for d1jnfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnfa1