SCOPe 2.06: Domain d1jnfa1: 1jnf A:3-334

Lineage for d1jnfa1 (1jnf A:3-334)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries)

8. Domain d1jnfa1: 1jnf A:3-334 [63196]
   complexed with cl, co3, fe

Details for d1jnfa1

PDB Entry: 1jnf, 2.6 Å

PDB Description: rabbit serum transferrin at 2.6 a resolution.

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d1jnfa1:

Sequence; same for both SEQRES and ATOM records:

>d1jnfa1 c.94.1.2 (A:3-334) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ektvrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtl
daglvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtgl
grsagwnipiglllcdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcssv
qpyfgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqch
larvpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygf
fkvpprmdanlylgyeyvtavrnlregicpdp

Timeline for d1jnfa1:

• d1jnfa1 first appeared in SCOP 1.57
  
• d1jnfa1 appears in SCOPe 2.05
  
• d1jnfa1 appears in SCOPe 2.07
  
• d1jnfa1 appears in the current release, SCOPe 2.08