Lineage for d1jnfa1 (1jnf A:3-334)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128115Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 128116Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 128300Family c.94.1.2: Transferrin [53888] (3 proteins)
  6. 128371Protein Transferrin [53897] (3 species)
  7. 128391Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries)
  8. 128392Domain d1jnfa1: 1jnf A:3-334 [63196]

Details for d1jnfa1

PDB Entry: 1jnf (more details), 2.6 Å

PDB Description: rabbit serum transferrin at 2.6 a resolution.

SCOP Domain Sequences for d1jnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnfa1 c.94.1.2 (A:3-334) Transferrin {Rabbit (Oryctolagus cuniculus)}
ektvrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtl
daglvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtgl
grsagwnipiglllcdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcssv
qpyfgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqch
larvpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygf
fkvpprmdanlylgyeyvtavrnlregicpdp

SCOP Domain Coordinates for d1jnfa1:

Click to download the PDB-style file with coordinates for d1jnfa1.
(The format of our PDB-style files is described here.)

Timeline for d1jnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jnfa2