Lineage for d1jnfa1 (1jnf A:3-334)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.2: Transferrin [53888] (3 proteins) Protein Transferrin [53897] (2 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53898] (2 PDB entries) 
Domain d1jnfa1: 1jnf A:3-334 [63196]
Details for d1jnfa1
PDB Entry: 1jnf (more details), 2.6 Å
PDB Description: rabbit serum transferrin at 2.6 a resolution.
SCOP Domain Sequences for d1jnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnfa1 c.94.1.2 (A:3-334) Transferrin {Rabbit (Oryctolagus cuniculus)}
ektvrwcavndheaskcanfrdsmkkvlpedgpriicvkkasyldcikaiaaheadavtl
daglvheagltpnnlkpvvaefygskenpktfyyavalvkkgsnfqlnelqgkkschtgl
grsagwnipiglllcdlpeprkplekavasffsgscvpcadgadfpqlcqlcpgcgcssv
qpyfgysgafkclkdglgdvafvkqetifenlpskderdqyellcldntrkpvdeyeqch
larvpshavvarsvdgkedliwellnqaqehfgkdksgdfqlfssphgknllfkdsaygf
fkvpprmdanlylgyeyvtavrnlregicpdp
SCOP Domain Coordinates for d1jnfa1:
Click to download the PDB-style file with coordinates for d1jnfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jnfa1:
- d1jnfa1 is new in SCOP 1.57
- d1jnfa1 appears in SCOP 1.59
- d1jnfa1 appears in the current release, SCOPe 2.08
View in 3D
