Lineage for d1jmya1 (1jmy A:1-518)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134231Protein Bile-salt activated lipase (cholesterol esterase) [53482] (2 species)
  7. 2134237Species Human (Homo sapiens) [TaxId:9606] [53484] (2 PDB entries)
  8. 2134239Domain d1jmya1: 1jmy A:1-518 [63182]
    Other proteins in same PDB: d1jmya2
    truncated recombinant enzyme
    complexed with so4

Details for d1jmya1

PDB Entry: 1jmy (more details), 2.6 Å

PDB Description: Truncated Recombinant Human Bile Salt Stimulated Lipase
PDB Compounds: (A:) bile-salt-activated lipase

SCOPe Domain Sequences for d1jmya1:

Sequence, based on SEQRES records: (download)

>d1jmya1 c.69.1.1 (A:1-518) Bile-salt activated lipase (cholesterol esterase) {Human (Homo sapiens) [TaxId: 9606]}
aklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknf
kkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfl
nnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaa
fggdpnnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkv
aekvgcpvgdaarmaqclkvtdpraltlaykvplagleypmlhyvgfvpvidgdfipadp
inlyanaadidyiagtnnmdghifasidmprinkgnkkvteedfyklvseftitkglrga
kttfdvyteswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfsh
psrmpvypkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmg
dsavpthwepyttensgyleitkkmgsssmkrslrtnf

Sequence, based on observed residues (ATOM records): (download)

>d1jmya1 c.69.1.1 (A:1-518) Bile-salt activated lipase (cholesterol esterase) {Human (Homo sapiens) [TaxId: 9606]}
aklgavyteggfvegvnkklgllgdsvdifkgipfaaptkalenpqphpgwqgtlkaknf
kkrclqatitqdstygdedclylniwvpqgrkqvsrdlpvmiwiyggaflmgsghganfl
nnylydgeeiatrgnvivvtfnyrvgplgflstgdanlpgnyglrdqhmaiawvkrniaa
fggdpnnitlfgesaggasvslqtlspynkglirraisqsgvalspwviqknplfwakkv
aekvgcpvgdaarmaqclkvtdpraltlaykvpmlhyvgfvpvidgdfipadpinlyana
adidyiagtnnmdghifasidmprinkgnkkvteedfyklvseftitkglrgakttfdvy
teswaqdpsqenkkktvvdfetdvlflvpteialaqhranaksaktyaylfshpsrmpvy
pkwvgadhaddiqyvfgkpfatptgyrpqdrtvskamiaywtnfaktgdpnmgdsavpth
wepyttensgyleitkkmgsssmkrslrtnf

SCOPe Domain Coordinates for d1jmya1:

Click to download the PDB-style file with coordinates for d1jmya1.
(The format of our PDB-style files is described here.)

Timeline for d1jmya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jmya2