SCOP 1.61: Domain d1jmab1: 1jma B:4-59

Lineage for d1jmab1 (1jma B:4-59)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)

4. Superfamily g.24.1: TNF receptor-like [57586] (1 family)

5. Family g.24.1.1: TNF receptor-like [57587] (3 proteins)

6. Protein Cellular receptor HveA [64568] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64569] (1 PDB entry)

8. Domain d1jmab1: 1jma B:4-59 [63178]
   Other proteins in same PDB: d1jmaa_

Details for d1jmab1

PDB Entry: 1jma, 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem

SCOP Domain Sequences for d1jmab1:

Sequence; same for both SEQRES and ATOM records:

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens)}
ckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

Timeline for d1jmab1:

• d1jmab1 first appeared in SCOP 1.57
  
• d1jmab1 appears in SCOP 1.59
  
• d1jmab1 appears in SCOP 1.63
  
• d1jmab1 appears in the current release, SCOPe 2.08