Lineage for d1jmaa_ (1jma A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101992Protein HSV glycoprotein D [63637] (1 species)
  7. 101993Species Herpes simplex virus type 1 [TaxId:10298] [63638] (1 PDB entry)
  8. 101994Domain d1jmaa_: 1jma A: [63177]
    Other proteins in same PDB: d1jmab1, d1jmab2

Details for d1jmaa_

PDB Entry: 1jma (more details), 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem
PDB Compounds: (A:)

SCOP Domain Sequences for d1jmaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmaa_ b.1.1.1 (A:) HSV glycoprotein D {Herpes simplex virus type 1}
kyaladaslkmadpnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyya
vleracrsvllnapseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsy
nkslgacpirtqprwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfi
lehrakgsckyalplrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiag
whgpkapytstllppelse

SCOP Domain Coordinates for d1jmaa_:

Click to download the PDB-style file with coordinates for d1jmaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jmaa_: