Lineage for d1jmaa_ (1jma A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739723Protein HSV glycoprotein D [63637] (1 species)
  7. 2739724Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries)
    elaborated with insertions and N- and C-terminal extensions
  8. 2739725Domain d1jmaa_: 1jma A: [63177]
    Other proteins in same PDB: d1jmab1, d1jmab2
    complexed with so4
    has additional insertions and/or extensions that are not grouped together

Details for d1jmaa_

PDB Entry: 1jma (more details), 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem
PDB Compounds: (A:) glycoprotein d

SCOPe Domain Sequences for d1jmaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmaa_ b.1.1.1 (A:) HSV glycoprotein D {Herpes simplex virus type 1 [TaxId: 10298]}
kyaladaslkmadpnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyya
vleracrsvllnapseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsy
nkslgacpirtqprwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfi
lehrakgsckyalplrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiag
whgpkapytstllppelse

SCOPe Domain Coordinates for d1jmaa_:

Click to download the PDB-style file with coordinates for d1jmaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jmaa_: