![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein HSV glycoprotein D [63637] (1 species) |
![]() | Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries) elaborated with insertions and N- and C-terminal extensions |
![]() | Domain d1jmaa_: 1jma A: [63177] Other proteins in same PDB: d1jmab1, d1jmab2 complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jma (more details), 2.65 Å
SCOPe Domain Sequences for d1jmaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmaa_ b.1.1.1 (A:) HSV glycoprotein D {Herpes simplex virus type 1 [TaxId: 10298]} kyaladaslkmadpnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyya vleracrsvllnapseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsy nkslgacpirtqprwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfi lehrakgsckyalplrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiag whgpkapytstllppelse
Timeline for d1jmaa_: