SCOPe 2.04: Domain d1jlna_: 1jln A:

Lineage for d1jlna_ (1jln A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry)

8. Domain d1jlna_: 1jln A: [63172]

Details for d1jlna_

PDB Entry: 1jln, 1.81 Å

PDB Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7

PDB Compounds: (A:) Protein Tyrosine Phosphatase, receptor type, R

SCOPe Domain Sequences for d1jlna_:

Sequence; same for both SEQRES and ATOM records:

>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]}
gsprekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtkn
ryktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqm
vwqedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgs
htqhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfi
atsigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv

Timeline for d1jlna_:

• d1jlna_ first appeared in SCOP 1.57
  
• d1jlna_ appears in SCOPe 2.03
  
• d1jlna_ appears in SCOPe 2.05
  
• d1jlna_ appears in the current release, SCOPe 2.08, called d1jlna1