Lineage for d1jljc_ (1jlj C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72494Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
  4. 72495Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 72496Family c.57.1.1: MogA-like [53219] (2 proteins)
  6. 72497Protein Gephyrin N-terminal domain [64100] (2 species)
  7. 72498Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry)
  8. 72501Domain d1jljc_: 1jlj C: [63171]

Details for d1jljc_

PDB Entry: 1jlj (more details), 1.6 Å

PDB Description: 1.6 Angstrom crystal structure of the human neuroreceptor anchoring and molybdenum cofactor biosynthesis protein gephyrin

SCOP Domain Sequences for d1jljc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jljc_ c.57.1.1 (C:) Gephyrin N-terminal domain {Human (Homo sapiens)}
hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd

SCOP Domain Coordinates for d1jljc_:

Click to download the PDB-style file with coordinates for d1jljc_.
(The format of our PDB-style files is described here.)

Timeline for d1jljc_: