Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) |
Family c.57.1.1: MogA-like [53219] (2 proteins) |
Protein Gephyrin N-terminal domain [64100] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry) |
Domain d1jljc_: 1jlj C: [63171] |
PDB Entry: 1jlj (more details), 1.6 Å
SCOP Domain Sequences for d1jljc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jljc_ c.57.1.1 (C:) Gephyrin N-terminal domain {Human (Homo sapiens)} hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd
Timeline for d1jljc_: