Lineage for d1jljb_ (1jlj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142860Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2142861Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2142862Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2142863Protein Gephyrin N-terminal domain [64100] (2 species)
  7. 2142864Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry)
    the human neuroreceptor anchoring protein
  8. 2142866Domain d1jljb_: 1jlj B: [63170]
    complexed with fmt, na

Details for d1jljb_

PDB Entry: 1jlj (more details), 1.6 Å

PDB Description: 1.6 Angstrom crystal structure of the human neuroreceptor anchoring and molybdenum cofactor biosynthesis protein gephyrin
PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d1jljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jljb_ c.57.1.1 (B:) Gephyrin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd

SCOPe Domain Coordinates for d1jljb_:

Click to download the PDB-style file with coordinates for d1jljb_.
(The format of our PDB-style files is described here.)

Timeline for d1jljb_: