SCOPe 2.05: Domain d1jljb_: 1jlj B:

Lineage for d1jljb_ (1jlj B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein Gephyrin N-terminal domain [64100] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry)
   the human neuroreceptor anchoring protein

8. Domain d1jljb_: 1jlj B: [63170]
   complexed with fmt, na

Details for d1jljb_

PDB Entry: 1jlj, 1.6 Å

PDB Description: 1.6 Angstrom crystal structure of the human neuroreceptor anchoring and molybdenum cofactor biosynthesis protein gephyrin

PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d1jljb_:

Sequence; same for both SEQRES and ATOM records:

>d1jljb_ c.57.1.1 (B:) Gephyrin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd

Timeline for d1jljb_:

• d1jljb_ first appeared in SCOP 1.57
  
• d1jljb_ appears in SCOPe 2.04
  
• d1jljb_ appears in SCOPe 2.06
  
• d1jljb_ appears in the current release, SCOPe 2.08