SCOP 1.57: Domain d1jlja_: 1jlj A:

Lineage for d1jlja_ (1jlj A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.1: MogA-like [53219] (2 proteins)

6. Protein Gephyrin N-terminal domain [64100] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64102] (1 PDB entry)

8. Domain d1jlja_: 1jlj A: [63169]

Details for d1jlja_

PDB Entry: 1jlj, 1.6 Å

PDB Description: 1.6 Angstrom crystal structure of the human neuroreceptor anchoring and molybdenum cofactor biosynthesis protein gephyrin

SCOP Domain Sequences for d1jlja_:

Sequence; same for both SEQRES and ATOM records:

>d1jlja_ c.57.1.1 (A:) Gephyrin N-terminal domain {Human (Homo sapiens)}
hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd

Timeline for d1jlja_:

• d1jlja_ is new in SCOP 1.57
  
• d1jlja_ appears in SCOP 1.59
  
• d1jlja_ appears in the current release, SCOPe 2.08