SCOP 1.59: Domain d1jl8b1: 1jl8 B:1-120

Lineage for d1jl8b1 (1jl8 B:1-120)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (25 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (2 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (4 PDB entries)

8. Domain d1jl8b1: 1jl8 B:1-120 [63166]
   Other proteins in same PDB: d1jl8a2, d1jl8a3, d1jl8b2, d1jl8b3

Details for d1jl8b1

PDB Entry: 1jl8, 3.2 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with beta-cyclodextrin based on a co-crystallization with methyl beta-cyclodextrin

SCOP Domain Sequences for d1jl8b1:

Sequence; same for both SEQRES and ATOM records:

>d1jl8b1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1jl8b1:

• d1jl8b1 first appeared in SCOP 1.57
  
• d1jl8b1 appears in SCOP 1.61
  
• d1jl8b1 appears in the current release, SCOPe 2.08