![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) ![]() |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries) |
![]() | Domain d1jl8a2: 1jl8 A:503-585 [63164] Other proteins in same PDB: d1jl8a1, d1jl8a3, d1jl8b1, d1jl8b3 |
PDB Entry: 1jl8 (more details), 3.2 Å
SCOP Domain Sequences for d1jl8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl8a2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII} gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev hgkqgqlkltlrpyqgmilwngr
Timeline for d1jl8a2: