Lineage for d1jl8a1 (1jl8 A:1-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105115Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 105116Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (4 PDB entries)
  8. 105121Domain d1jl8a1: 1jl8 A:1-120 [63163]
    Other proteins in same PDB: d1jl8a2, d1jl8a3, d1jl8b2, d1jl8b3

Details for d1jl8a1

PDB Entry: 1jl8 (more details), 3.2 Å

PDB Description: complex of alpha-amylase ii (tva ii) from thermoactinomyces vulgaris r-47 with beta-cyclodextrin based on a co-crystallization with methyl beta-cyclodextrin

SCOP Domain Sequences for d1jl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl8a1 b.1.1.5 (A:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1jl8a1:

Click to download the PDB-style file with coordinates for d1jl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1jl8a1: