SCOPe 2.06: Domain d1jl4d2: 1jl4 D:98-178

Lineage for d1jl4d2 (1jl4 D:98-178)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.3: C2 set domains [49142] (8 proteins)
Protein CD4 C2-set domains [49149] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)
Domain d1jl4d2: 1jl4 D:98-178 [63162]
Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4b3, d1jl4d1
domain 2

Details for d1jl4d2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

PDB Compounds: (D:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1jl4d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4d2 b.1.1.3 (D:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d1jl4d2:

Click to download the PDB-style file with coordinates for d1jl4d2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4d2: