![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (7 proteins) |
![]() | Protein CD4 [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (13 PDB entries) |
![]() | Domain d1jl4d2: 1jl4 D:98-178 [63162] Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d1 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4d2 b.1.1.3 (D:98-178) CD4 {Human (Homo sapiens)} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d1jl4d2:
![]() Domains from other chains: (mouse over for more information) d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2 |