SCOP 1.63: Domain d1jl4d1: 1jl4 D:1-97

Lineage for d1jl4d1 (1jl4 D:1-97)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)

8. Domain d1jl4d1: 1jl4 D:1-97 [63161]
   Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d2

Details for d1jl4d1

PDB Entry: 1jl4, 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4d1:

Sequence; same for both SEQRES and ATOM records:

>d1jl4d1 b.1.1.1 (D:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1jl4d1:

• d1jl4d1 first appeared in SCOP 1.57
  
• d1jl4d1 appears in SCOP 1.61
  
• d1jl4d1 appears in SCOP 1.65
  
• d1jl4d1 appears in the current release, SCOPe 2.08