![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein N-terminal domain of CD4 [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries) |
![]() | Domain d1jl4d1: 1jl4 D:1-97 [63161] Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4d1 b.1.1.1 (D:1-97) N-terminal domain of CD4 {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1jl4d1:
![]() Domains from other chains: (mouse over for more information) d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2 |