Lineage for d1jl4d1 (1jl4 D:1-97)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52814Protein N-terminal domain of CD4 [48737] (2 species)
  7. 52815Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
  8. 52825Domain d1jl4d1: 1jl4 D:1-97 [63161]
    Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b2, d1jl4d2

Details for d1jl4d1

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4d1 b.1.1.1 (D:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1jl4d1:

Click to download the PDB-style file with coordinates for d1jl4d1.
(The format of our PDB-style files is described here.)

Timeline for d1jl4d1: