Lineage for d1jl4b2 (1jl4 B:5-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501530Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)
  8. 501532Domain d1jl4b2: 1jl4 B:5-92 [63160]
    Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4d1, d1jl4d2

Details for d1jl4b2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule
PDB Compounds: (B:)

SCOP Domain Sequences for d1jl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4b2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

SCOP Domain Coordinates for d1jl4b2:

Click to download the PDB-style file with coordinates for d1jl4b2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4b2: