Lineage for d1jl4b2 (1jl4 B:5-92)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131977Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)
  7. 132045Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (3 PDB entries)
  8. 132053Domain d1jl4b2: 1jl4 B:5-92 [63160]
    Other proteins in same PDB: d1jl4a1, d1jl4b1, d1jl4d1, d1jl4d2

Details for d1jl4b2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule

SCOP Domain Sequences for d1jl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4b2 d.19.1.1 (B:5-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr

SCOP Domain Coordinates for d1jl4b2:

Click to download the PDB-style file with coordinates for d1jl4b2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4b2: