| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) |
| Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species) |
| Species Mouse (Mus musculus), I-AK [TaxId:10090] [54464] (3 PDB entries) |
| Domain d1jl4b2: 1jl4 B:5-92 [63160] Other proteins in same PDB: d1jl4a1, d1jl4b1, d1jl4d1, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4b2 d.19.1.1 (B:5-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AK}
gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
ylertraeldtvcrhnyektetptslr
Timeline for d1jl4b2:
View in 3DDomains from other chains: (mouse over for more information) d1jl4a1, d1jl4a2, d1jl4d1, d1jl4d2 |