Lineage for d1jl4b2 (1jl4 B:7-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938469Species Mouse (Mus musculus), I-AK [TaxId:10090] [88826] (3 PDB entries)
  8. 2938473Domain d1jl4b2: 1jl4 B:7-92 [63160]
    Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b1, d1jl4b3, d1jl4d1, d1jl4d2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1jl4b2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule
PDB Compounds: (B:) h-2 class II histocompatibility antigen, a-k beta chain

SCOPe Domain Sequences for d1jl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4b2 d.19.1.1 (B:7-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
fvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkqyl
ertraeldtvcrhnyektetptslr

SCOPe Domain Coordinates for d1jl4b2:

Click to download the PDB-style file with coordinates for d1jl4b2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4b2: