Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1jl4b1: 1jl4 B:93-190 [63159] Other proteins in same PDB: d1jl4a1, d1jl4a2, d1jl4b2, d1jl4d1, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4b1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group} rleqpsvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd wtfqvlvmlemtprrgevytchvehpsltspitvewra
Timeline for d1jl4b1:
View in 3D Domains from other chains: (mouse over for more information) d1jl4a1, d1jl4a2, d1jl4d1, d1jl4d2 |