Lineage for d1jl4a2 (1jl4 A:5-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183320Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (4 PDB entries)
  8. 2183325Domain d1jl4a2: 1jl4 A:5-81 [63158]
    Other proteins in same PDB: d1jl4a1, d1jl4b1, d1jl4b2, d1jl4b3, d1jl4d1, d1jl4d2

Details for d1jl4a2

PDB Entry: 1jl4 (more details), 4.3 Å

PDB Description: crystal structure of the human cd4 n-terminal two domain fragment complexed to a class ii mhc molecule
PDB Compounds: (A:) h-2 class II histocompatibility antigen, a-k alpha chain

SCOPe Domain Sequences for d1jl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl4a2 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
hvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgglqni
atgkhnleiltkrsnstp

SCOPe Domain Coordinates for d1jl4a2:

Click to download the PDB-style file with coordinates for d1jl4a2.
(The format of our PDB-style files is described here.)

Timeline for d1jl4a2: