![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (3 PDB entries) |
![]() | Domain d1jl4a2: 1jl4 A:5-81 [63158] Other proteins in same PDB: d1jl4a1, d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2 |
PDB Entry: 1jl4 (more details), 4.3 Å
SCOP Domain Sequences for d1jl4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl4a2 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK} hvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgglqni atgkhnleiltkrsnstp
Timeline for d1jl4a2:
![]() Domains from other chains: (mouse over for more information) d1jl4b1, d1jl4b2, d1jl4d1, d1jl4d2 |