Lineage for d1jk9d2 (1jk9 D:3-73)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953947Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species)
  7. 2953948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries)
  8. 2953952Domain d1jk9d2: 1jk9 D:3-73 [63154]
    Other proteins in same PDB: d1jk9a_, d1jk9b1, d1jk9c_, d1jk9d1
    complexed with so4, zn

Details for d1jk9d2

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs
PDB Compounds: (D:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d1jk9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9d2 d.58.17.1 (D:3-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlr
ncgkdaiirga

SCOPe Domain Coordinates for d1jk9d2:

Click to download the PDB-style file with coordinates for d1jk9d2.
(The format of our PDB-style files is described here.)

Timeline for d1jk9d2: