Lineage for d1jk9d1 (1jk9 D:74-245)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367295Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 367296Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 367297Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)
  7. 367298Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries)
  8. 367303Domain d1jk9d1: 1jk9 D:74-245 [63153]
    Other proteins in same PDB: d1jk9a_, d1jk9b2, d1jk9c_, d1jk9d2
    complexed with so4, zn; mutant

Details for d1jk9d1

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

SCOP Domain Sequences for d1jk9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9d1 b.1.8.1 (D:74-245) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvwennkqvcactgktvweerkdala

SCOP Domain Coordinates for d1jk9d1:

Click to download the PDB-style file with coordinates for d1jk9d1.
(The format of our PDB-style files is described here.)

Timeline for d1jk9d1: