![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
![]() | Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries) |
![]() | Domain d1jk9d1: 1jk9 D:74-245 [63153] Other proteins in same PDB: d1jk9a_, d1jk9b2, d1jk9c_, d1jk9d2 complexed with so4, zn; mutant |
PDB Entry: 1jk9 (more details), 2.9 Å
SCOP Domain Sequences for d1jk9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk9d1 b.1.8.1 (D:74-245) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis kslnhpenepssvkdysflgviarsagvwennkqvcactgktvweerkdala
Timeline for d1jk9d1:
![]() Domains from other chains: (mouse over for more information) d1jk9a_, d1jk9b1, d1jk9b2, d1jk9c_ |