SCOP 1.67: Domain d1jk9c_: 1jk9 C:

Lineage for d1jk9c_ (1jk9 C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1jk9c_: 1jk9 C: [63152]
   Other proteins in same PDB: d1jk9b1, d1jk9b2, d1jk9d1, d1jk9d2
   complexed with Yccs copper chaperone
   complexed with so4, zn; mutant

Details for d1jk9c_

PDB Entry: 1jk9, 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

SCOP Domain Sequences for d1jk9c_:

Sequence; same for both SEQRES and ATOM records:

>d1jk9c_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhifefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1jk9c_:

• d1jk9c_ first appeared in SCOP 1.57
  
• d1jk9c_ appears in SCOP 1.65
  
• d1jk9c_ appears in SCOP 1.69
  
• d1jk9c_ appears in the current release, SCOPe 2.08