Lineage for d1jk9c_ (1jk9 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763736Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)
  8. 2763753Domain d1jk9c_: 1jk9 C: [63152]
    Other proteins in same PDB: d1jk9b1, d1jk9b2, d1jk9d1, d1jk9d2
    complexed with Yccs copper chaperone
    complexed with so4, zn

Details for d1jk9c_

PDB Entry: 1jk9 (more details), 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1jk9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk9c_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhifefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

SCOPe Domain Coordinates for d1jk9c_:

Click to download the PDB-style file with coordinates for d1jk9c_.
(The format of our PDB-style files is described here.)

Timeline for d1jk9c_: