SCOPe 2.08: Domain d1jk9b2: 1jk9 B:3-73

Lineage for d1jk9b2 (1jk9 B:3-73)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries)

8. Domain d1jk9b2: 1jk9 B:3-73 [63151]
   Other proteins in same PDB: d1jk9a_, d1jk9b1, d1jk9c_, d1jk9d1
   complexed with so4, zn

Details for d1jk9b2

PDB Entry: 1jk9, 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

PDB Compounds: (B:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d1jk9b2:

Sequence; same for both SEQRES and ATOM records:

>d1jk9b2 d.58.17.1 (B:3-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlr
ncgkdaiirga

Timeline for d1jk9b2:

• d1jk9b2 first appeared in SCOP 1.57
  
• d1jk9b2 appears in SCOPe 2.07