SCOPe 2.08: Domain d1jk9b1: 1jk9 B:74-245

Lineage for d1jk9b1 (1jk9 B:74-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (3 PDB entries)

8. Domain d1jk9b1: 1jk9 B:74-245 [63150]
   Other proteins in same PDB: d1jk9a_, d1jk9b2, d1jk9c_, d1jk9d2
   complexed with so4, zn

Details for d1jk9b1

PDB Entry: 1jk9, 2.9 Å

PDB Description: heterodimer between h48f-ysod1 and yccs

PDB Compounds: (B:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d1jk9b1:

Sequence; same for both SEQRES and ATOM records:

>d1jk9b1 b.1.8.1 (B:74-245) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasi
hekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvis
kslnhpenepssvkdysflgviarsagvwennkqvcactgktvweerkdala

Timeline for d1jk9b1:

• d1jk9b1 first appeared in SCOP 1.57
  
• d1jk9b1 appears in SCOPe 2.07