Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries) |
Domain d1jk9a_: 1jk9 A: [63149] Other proteins in same PDB: d1jk9b1, d1jk9b2, d1jk9d1, d1jk9d2 complexed with Yccs copper chaperone complexed with so4, zn |
PDB Entry: 1jk9 (more details), 2.9 Å
SCOPe Domain Sequences for d1jk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk9a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhifefgdatngcvsa gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih agqddlgkgdteeslktgnagprpacgvigltn
Timeline for d1jk9a_: