Lineage for d1jk8a2 (1jk8 A:2-84)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131977Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)
  7. 131981Species Human (Homo sapiens), HLA-DQ8 [TaxId:9606] [64238] (1 PDB entry)
  8. 131982Domain d1jk8a2: 1jk8 A:2-84 [63146]
    Other proteins in same PDB: d1jk8a1, d1jk8b1

Details for d1jk8a2

PDB Entry: 1jk8 (more details), 2.4 Å

PDB Description: crystal structure of a human insulin peptide-hla-dq8 complex

SCOP Domain Sequences for d1jk8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk8a2 d.19.1.1 (A:2-84) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DQ8}
vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
tniavlkhnlnivikrsnstaatn

SCOP Domain Coordinates for d1jk8a2:

Click to download the PDB-style file with coordinates for d1jk8a2.
(The format of our PDB-style files is described here.)

Timeline for d1jk8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jk8a1